Structure of PDB 3s90 Chain B Binding Site BS01

Receptor Information
>3s90 Chain B (length=251) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAV
SNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYS
VPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVV
ETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKEL
LPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLT
S
Ligand information
>3s90 Chain D (length=26) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TAKRQFVQSAKEVANSTANLVKTIKA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3s90 Intermolecular versus intramolecular interactions of the vinculin binding site 33 of talin.
Resolution1.97 Å
Binding residue
(original residue number in PDB)		I12 V16 Q19 V47 A50 L54 V57 M74 L88 I115 L122 F126
Binding residue
(residue number reindexed from 1)		I11 V15 Q18 V46 A49 L53 V56 M73 L87 I114 L121 F125
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005198 structural molecule activity
GO:0051015 actin filament binding
Biological Process
GO:0007155 cell adhesion
Cellular Component
GO:0015629 actin cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3s90, PDBe:3s90, PDBj:3s90
PDBsum3s90
PubMed21648001
UniProtP18206|VINC_HUMAN Vinculin (Gene Name=VCL)

[Back to BioLiP]