Structure of PDB 2iui Chain B Binding Site BS01

Receptor Information
>2iui Chain B (length=110) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NNNMSLQNAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTL
RKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDV
KLLYPVSKYQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2iui Crystal Structure of the Pi 3-Kinase P85 Amino- Terminal Sh2 Domain and its Phosphopeptide Complexes
Resolution2.4 Å
Binding residue
(original residue number in PDB)
R1019 R1037 A1039 S1040 T1048 L1059 K1061 S1072 D1073 Y1095 N1096 L1099
Binding residue
(residue number reindexed from 1)
R18 R36 A38 S39 T47 L58 K60 S71 D72 Y94 N95 L98
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2iui, PDBe:2iui, PDBj:2iui
PDBsum2iui
PubMed8599763
UniProtP27986|P85A_HUMAN Phosphatidylinositol 3-kinase regulatory subunit alpha (Gene Name=PIK3R1)

[Back to BioLiP]