Structure of PDB 2a6i Chain B Binding Site BS01

Receptor Information
>2a6i Chain B (length=219) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLQQSGAELVRAGSSVKMSCKASGYTFTSYGINWVKQRPGQGLEWIGY
INPGNGYTKYNEKFKGKTTLTVDKSSSTAYMQLRSLTSEDSAVYFCARSV
YYGGSYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSANSMVTLGCLVKGY
FPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTC
NVAHPASSTKVDKKIVPRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2a6i Differential epitope positioning within the germline antibody paratope enhances promiscuity in the primary immune response.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		S31 Y32 G33 N35 Y50 S99 V100 Y101 Y102 G103 G104 Y106 Y107
Binding residue
(residue number reindexed from 1)		S31 Y32 G33 N35 Y50 S99 V100 Y101 Y102 G103 G104 Y106 Y107
External links