Structure of PDB 1m07 Chain B Binding Site BS01

Receptor Information
>1m07 Chain B (length=111) Species: 8400 (Aquarana catesbeiana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QNWATFQQKHIINTPIINCNTIMDNNIYIVGGQCKRVNTFIISSATTVKA
ICTGVINMNVLSTTRFQLNTCTRTSITPRPCPYSSRTETNYICVKCENQY
PVHFAGIGRCP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1m07 Residues involved in the catalysis, base specificity, and cytotoxicity of ribonuclease from Rana catesbeiana based upon mutagenesis and X-ray crystallography
Resolution1.8 Å
Binding residue
(original residue number in PDB)		I56 N57 E97
Binding residue
(residue number reindexed from 1)		I56 N57 E97
Enzymatic activity
Enzyme Commision number 3.1.27.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004519 endonuclease activity
GO:0004540 RNA nuclease activity
GO:0030246 carbohydrate binding
Biological Process
GO:0050830 defense response to Gram-positive bacterium
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1m07, PDBe:1m07, PDBj:1m07
PDBsum1m07
PubMed12499382
UniProtP11916|RNASO_AQUCT Oocytes ribonuclease (Gene Name=RCR)

[Back to BioLiP]