Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 1loc Chain B Binding Site BS01

Receptor Information

>1loc Chain B (length=47) Species: 3858 (Lathyrus ochrus)

ETSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSWYFHSELA

Ligand information

>1loc Chain 1 (length=3) Species: 32630 (synthetic construct)

gAE

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1loc Interaction of a legume lectin with two components of the bacterial cell wall. A crystallographic study.
• Resolution: 2.05 Å
• Binding residue (original residue number in PDB): G29 A30
• Binding residue (residue number reindexed from 1): G29 A30

Gene Ontology

Molecular Function

• GO:0005537 D-mannose binding
• GO:0030246 carbohydrate binding

External links

• PDB: RCSB:1loc, PDBe:1loc, PDBj:1loc
• PDBsum: 1loc
• PubMed: 8144527
• UniProt: P12306|LEC1_LATOC Mannose/glucose-specific lectin alpha 1 chain

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417