Structure of PDB 1jk8 Chain B Binding Site BS01

Receptor Information
>1jk8 Chain B (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTP
LGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTIS
PSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGD
WTFQILVMLEMTPQRGDVYTCHVEHPSLQNPIIVEWRAQS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jk8 Structure of a human insulin peptide-HLA-DQ8 complex and susceptibility to type 1 diabetes.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		F11 G13 C15 L26 T28 Y30 Y37 A57 Y60 W61 E74 V78 C79 H81 N82 L85
Binding residue
(residue number reindexed from 1)		F9 G11 C13 L24 T26 Y28 Y35 A55 Y58 W59 E72 V76 C77 H79 N80 L83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1jk8, PDBe:1jk8, PDBj:1jk8
PDBsum1jk8
PubMed11376336
UniProtP01920|DQB1_HUMAN HLA class II histocompatibility antigen, DQ beta 1 chain (Gene Name=HLA-DQB1)

[Back to BioLiP]