Structure of PDB 1j82 Chain B Binding Site BS01

Receptor Information
>1j82 Chain B (length=101) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCY
QSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDAS
V
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1j82 Osmolytes stabilize ribonuclease S by stabilizing its fragments S protein and S peptide to compact folding-competent states.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		N24 Y25 R33 N44 T45 F46 V47 H48 E49 L51 H119
Binding residue
(residue number reindexed from 1)		N1 Y2 R10 N21 T22 F23 V24 H25 E26 L28 H96
Enzymatic activity
Catalytic site (original residue number in PDB) K41 H119 F120 D121
Catalytic site (residue number reindexed from 1) K18 H96 F97 D98
Enzyme Commision number 4.6.1.18: pancreatic ribonuclease.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:1j82, PDBe:1j82, PDBj:1j82
PDBsum1j82
PubMed11373282
UniProtP61823|RNAS1_BOVIN Ribonuclease pancreatic (Gene Name=RNASE1)

[Back to BioLiP]