Structure of PDB 1hqr Chain B Binding Site BS01

Receptor Information
>1hqr Chain B (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTRPRFLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFDSDVGEYRAVT
ELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRRVEPKVTV
YPAHNLLVCSVNGFYPGSIEVRWFRNSQEEKAGVVSTGLIQNGDWTFQTL
VMLETVPREVYTCQVEHPSVTSPLTVEWRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hqr Crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on MHC class II.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		Y213 W261 F267 R271 Y278 N282 V285
Binding residue
(residue number reindexed from 1)		Y12 W60 F66 R70 Y77 N81 V84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1hqr, PDBe:1hqr, PDBj:1hqr
PDBsum1hqr
PubMed11163233
UniProtQ30154|DRB5_HUMAN HLA class II histocompatibility antigen, DR beta 5 chain (Gene Name=HLA-DRB5)

[Back to BioLiP]