Structure of PDB 1gss Chain B Binding Site BS01

Receptor Information
>1gss Chain B (length=209) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYG
QLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLR
CKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISF
ADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVN
LPINGNGKQ
Ligand information
Ligand IDLEE
InChIInChI=1S/C16H29N3O6S/c1-2-3-4-5-8-26-10-12(15(23)18-9-14(21)22)19-13(20)7-6-11(17)16(24)25/h11-12H,2-10,17H2,1H3,(H,18,23)(H,19,20)(H,21,22)(H,24,25)/t11-,12-/m0/s1
InChIKeyHXJDWCWJDCOHDG-RYUDHWBXSA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 1.7.0CCCCCCSCC(C(=O)NCC(=O)O)NC(=O)CCC(C(=O)O)N
ACDLabs 12.01O=C(NC(C(=O)NCC(=O)O)CSCCCCCC)CCC(C(=O)O)N
CACTVS 3.370CCCCCCSC[CH](NC(=O)CC[CH](N)C(O)=O)C(=O)NCC(O)=O
CACTVS 3.370CCCCCCSC[C@H](NC(=O)CC[C@H](N)C(O)=O)C(=O)NCC(O)=O
OpenEye OEToolkits 1.7.0CCCCCCSC[C@@H](C(=O)NCC(=O)O)NC(=O)CC[C@@H](C(=O)O)N
FormulaC16 H29 N3 O6 S
NameL-gamma-glutamyl-S-hexyl-L-cysteinylglycine
ChEMBLCHEMBL345292
DrugBankDB04132
ZINCZINC000003874923
PDB chain1gss Chain B Residue 208 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1gss Three-dimensional structure of class pi glutathione S-transferase from human placenta in complex with S-hexylglutathione at 2.8 A resolution.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		Y7 F8 R13 W38 K42 Q49 L50 Q62 S63 Y106
Binding residue
(residue number reindexed from 1)		Y7 F8 R13 W38 K44 Q51 L52 Q64 S65 Y108
Annotation score2
Binding affinityBindingDB: Ki=10000nM,IC50=1.31e+5nM
Enzymatic activity
Catalytic site (original residue number in PDB) Y7 R13
Catalytic site (residue number reindexed from 1) Y7 R13
Enzyme Commision number 2.5.1.18: glutathione transferase.
Gene Ontology
Molecular Function
GO:0004364 glutathione transferase activity
GO:0004602 glutathione peroxidase activity
GO:0005504 fatty acid binding
GO:0005515 protein binding
GO:0008432 JUN kinase binding
GO:0016740 transferase activity
GO:0019207 kinase regulator activity
GO:0035730 S-nitrosoglutathione binding
GO:0035731 dinitrosyl-iron complex binding
GO:0070026 nitric oxide binding
Biological Process
GO:0000302 response to reactive oxygen species
GO:0002674 negative regulation of acute inflammatory response
GO:0006469 negative regulation of protein kinase activity
GO:0006629 lipid metabolic process
GO:0006693 prostaglandin metabolic process
GO:0006749 glutathione metabolic process
GO:0006805 xenobiotic metabolic process
GO:0007417 central nervous system development
GO:0009890 negative regulation of biosynthetic process
GO:0010804 negative regulation of tumor necrosis factor-mediated signaling pathway
GO:0032691 negative regulation of interleukin-1 beta production
GO:0032720 negative regulation of tumor necrosis factor production
GO:0032872 regulation of stress-activated MAPK cascade
GO:0032873 negative regulation of stress-activated MAPK cascade
GO:0032930 positive regulation of superoxide anion generation
GO:0035726 common myeloid progenitor cell proliferation
GO:0035732 nitric oxide storage
GO:0043066 negative regulation of apoptotic process
GO:0043124 negative regulation of canonical NF-kappaB signal transduction
GO:0043407 negative regulation of MAP kinase activity
GO:0043409 negative regulation of MAPK cascade
GO:0043508 negative regulation of JUN kinase activity
GO:0043651 linoleic acid metabolic process
GO:0048147 negative regulation of fibroblast proliferation
GO:0051122 hepoxilin biosynthetic process
GO:0051771 negative regulation of nitric-oxide synthase biosynthetic process
GO:0070372 regulation of ERK1 and ERK2 cascade
GO:0070373 negative regulation of ERK1 and ERK2 cascade
GO:0070664 negative regulation of leukocyte proliferation
GO:0071222 cellular response to lipopolysaccharide
GO:0071638 negative regulation of monocyte chemotactic protein-1 production
GO:0098869 cellular oxidant detoxification
GO:1901687 glutathione derivative biosynthetic process
GO:2001237 negative regulation of extrinsic apoptotic signaling pathway
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0031982 vesicle
GO:0034774 secretory granule lumen
GO:0070062 extracellular exosome
GO:0097057 TRAF2-GSTP1 complex
GO:1904813 ficolin-1-rich granule lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1gss, PDBe:1gss, PDBj:1gss
PDBsum1gss
PubMed1522586
UniProtP09211|GSTP1_HUMAN Glutathione S-transferase P (Gene Name=GSTP1)

[Back to BioLiP]