BioLiP

Structure of PDB 1dm4 Chain B Binding Site BS01

Receptor Information

>1dm4 Chain B (length=252) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDAGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF
GE

Ligand information

>1dm4 Chain C (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DFLAEGGGVR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1dm4 Structure of the Ser195Ala mutant of human alpha--thrombin complexed with fibrinopeptide A(7--16): evidence for residual catalytic activity.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	H57 R97 E97A L99 R173 I174 D189 A190 A195 W215 G216
Binding residue (residue number reindexed from 1)	H43 R93 E94 L96 R171 I172 D192 A193 A198 W220 G221

Enzymatic activity

Catalytic site (original residue number in PDB)	H57 D102 E192 G193 D194 A195 G196
Catalytic site (residue number reindexed from 1)	H43 D99 E195 G196 D197 A198 G199
Enzyme Commision number	3.4.21.5: thrombin.

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity
GO:0005509	calcium ion binding

	Biological Process
GO:0006508	proteolysis
GO:0007596	blood coagulation

View graph for
Molecular Function

View graph for
Biological Process

PDB	RCSB:1dm4, PDBe:1dm4, PDBj:1dm4
PDBsum	1dm4
PubMed	10739913
UniProt	P00734\|THRB_HUMAN Prothrombin (Gene Name=F2)