Structure of PDB 1cwp Chain B Binding Site BS01

Receptor Information
>1cwp Chain B (length=164) Species: 12303 (Cowpea chlorotic mottle virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VVQPVIVEPIASGQGKAIKAWTGYSVSKWTASCAAAEAKVTSAITISLPN
ELSSERNKQLKVGRVLLWLGLLPSVSGTVKSCVTETQTTAAASFQVALAV
ADNSKDVVAAMYPEAFKGITLEQLAADLTIYLYSSAALTEGDVIVHLEVE
HVRPTFDDSFTPVY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cwp Structures of the native and swollen forms of cowpea chlorotic mottle virus determined by X-ray crystallography and cryo-electron microscopy.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		W47 E140 K143
Binding residue
(residue number reindexed from 1)		W21 E114 K117
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005198 structural molecule activity
Cellular Component
GO:0019013 viral nucleocapsid
GO:0019028 viral capsid
GO:0039617 T=3 icosahedral viral capsid
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1cwp, PDBe:1cwp, PDBj:1cwp
PDBsum1cwp
PubMed7743132
UniProtP03601|CAPSD_CCMV Capsid protein (Gene Name=ORF3b)

[Back to BioLiP]