Structure of PDB 1b8h Chain B Binding Site BS01

Receptor Information
>1b8h Chain B (length=228) Species: 12353 (Escherichia phage RB69) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKLSKDTIAILKNFASINSGILLSQGKFIMTRAVNGTTYAEANISDEIDF
DVALYDLNSFLSILSLVSDDAEISMHTDGNIKIADTRSTVYWPAADKSTI
VFPNKPIQFPVASVITEIKAEDLQQLLRVSRGLQIDTIAITNKDGKIVIN
GYNKVEDSGLTRPKYSLTLTDYDGSNNFNFVINMANMKIQPGNYKVMLWG
AGDKVAAKFESSQVSYVIAMEADSTHDF
Ligand information
>1b8h Chain D (length=11) Species: 12353 (Escherichia phage RB69) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KKASLFDMFDF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1b8h Building a replisome from interacting pieces: sliding clamp complexed to a peptide from DNA polymerase and a polymerase editing complex.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R32 G36 T37 N104 K105 I107 P110 V205 A206 A219 E221
Binding residue
(residue number reindexed from 1)		R32 G36 T37 N104 K105 I107 P110 V205 A206 A219 E221
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0030337 DNA polymerase processivity factor activity
Biological Process
GO:0006260 DNA replication
GO:0019083 viral transcription
GO:0039693 viral DNA genome replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1b8h, PDBe:1b8h, PDBj:1b8h
PDBsum1b8h
PubMed10535734
UniProtO80164|CLAMP_BPR69 Sliding clamp (Gene Name=45)

[Back to BioLiP]