Structure of PDB 1b2c Chain B Binding Site BS01

Receptor Information

>1b2c Chain B (length=30) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Ligand information

>1b2c Chain A (length=21) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GIVEQCCTSICSLYQLENYCN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1b2c Crystallographic titration of cubic insulin crystals: pH affects GluB13 switching and sulfate binding.
Resolution	1.8 Å
Binding residue (original residue number in PDB)	V2 Q4 H5 L6 C7 L15 C19 R22 G23 F24 F25 A30
Binding residue (residue number reindexed from 1)	V2 Q4 H5 L6 C7 L15 C19 R22 G23 F24 F25 A30

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005179	hormone activity

	Cellular Component
GO:0005576	extracellular region

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:1b2c, PDBe:1b2c, PDBj:1b2c
PDBsum	1b2c
PubMed	12657786
UniProt	P01315\|INS_PIG Insulin (Gene Name=INS)

[Back to BioLiP]