Structure of PDB 1a09 Chain B Binding Site BS01

Receptor Information
>1a09 Chain B (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNA
KGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTV
CP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1a09 Peptide ligands of pp60(c-src) SH2 domains: a thermodynamic and structural study.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
R158 R178 S180 E181 T182 C188 H204 Y205 K206 G239
Binding residue
(residue number reindexed from 1)
R11 R31 S33 E34 T35 C41 H57 Y58 K59 G92
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:1a09, PDBe:1a09, PDBj:1a09
PDBsum1a09
PubMed9174343
UniProtP12931|SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)

[Back to BioLiP]