Structure of PDB 8j9h Chain A1 Binding Site BS01

Receptor Information
>8j9h Chain A1 (length=137) Species: 3039 (Euglena gracilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PGGGGWSNMVPIIILNGVVWAALGRASLACSPPEFHKRTKNDTEFNKYLH
LRFNKAVQNPESVAGQAVKAGCAPEFRPFDSPANPLVVVYGWKDEIQPRP
NPGSLAQSFDDRGLSWYQSHFSNRVVDDPKHNSLPFP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8j9h Euglena's atypical respiratory chain adapts to the discoidal cristae and flexible metabolism.
Resolution3.11 Å
Binding residue
(original residue number in PDB)		F80 L115
Binding residue
(residue number reindexed from 1)		F79 L114
External links