Structure of PDB 8q7k Chain A Binding Site BS01

Receptor Information
>8q7k Chain A (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFL
VPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEK
DEDGFLYMVYASQET
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8q7k Tumor immune evasion through IRGQ-directed autophagy
Resolution1.6 Å
Binding residue
(original residue number in PDB)		R11 D19 I23 K49 K51 F52 L53 I66 R70 F108
Binding residue
(residue number reindexed from 1)		R8 D16 I20 K46 K48 F49 L50 I63 R67 F105
External links
PDB RCSB:8q7k, PDBe:8q7k, PDBj:8q7k
PDBsum8q7k
PubMed
UniProtQ9GZQ8|MLP3B_HUMAN Microtubule-associated proteins 1A/1B light chain 3B (Gene Name=MAP1LC3B)

[Back to BioLiP]