Structure of PDB 8alx Chain A Binding Site BS01

Receptor Information
>8alx Chain A (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVH
GEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYG
GADYKRITVKVNAPY
Ligand information
>8alx Chain B (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YANPALPWPWKKLCG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8alx Structural and biological characterization of pAC65, a macrocyclic peptide that blocks PD-L1 with equivalent potency to the FDA-approved antibodies.
Resolution1.1 Å
Binding residue
(original residue number in PDB)		I54 Y56 N63 Q66 V68 D73 V76 R113 C114 M115 Y123 R125
Binding residue
(residue number reindexed from 1)		I35 Y37 N44 Q47 V49 D54 V57 R94 C95 M96 Y104 R106
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8alx, PDBe:8alx, PDBj:8alx
PDBsum8alx
PubMed37679783
UniProtQ9NZQ7|PD1L1_HUMAN Programmed cell death 1 ligand 1 (Gene Name=CD274)

[Back to BioLiP]