Structure of PDB 7tt8 Chain A Binding Site BS01

Receptor Information
>7tt8 Chain A (length=235) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANKLSTFGLMCKMADQTL
FSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSI
FLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKF
LVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRL
PEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tt8 Differential Modulation of Nuclear Receptor LRH-1 through Targeting Buried and Surface Regions of the Binding Pocket.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R361 M375 Q379 N530 L531 E534 M535
Binding residue
(residue number reindexed from 1)		R58 M72 Q76 N227 L228 E231 M232
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity

View graph for
Molecular Function
External links
PDB RCSB:7tt8, PDBe:7tt8, PDBj:7tt8
PDBsum7tt8
PubMed35503419
UniProtO00482|NR5A2_HUMAN Nuclear receptor subfamily 5 group A member 2 (Gene Name=NR5A2)

[Back to BioLiP]