BioLiP

Structure of PDB 7qyr Chain A Binding Site BS01

Receptor Information

>7qyr Chain A (length=292) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MKIAVLSRNPRLYSTRRLVEAGRERGHEMVVIDTLRAYMNIASHKPQIHY
RGQPLEGFDAVIPRIGASVTFYGCAVLRQFEMMGVFPLNESVAIARSRDK
LRSLQLLSRKGIGLPVTGFAHSPDDVPDLIEMVGGAPLVIKLLEGTQGIG
VVLCETEKAAESVLEAFMGLKHNIMVQEYIKEAGGADIRCFVVGDKVIAS
MKRQAAPGEFRSNLHRGGSASLIKITPEERMTAIRAARVMGLNVAGVDIL
RSNHGPLVMEVNSSPGLEGIESTTGKDIAGIIIQYLEKNGGP

Ligand information

>7qyr Chain K (length=5) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EEEEE

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7qyr Structural insights into the mechanism of adaptive ribosomal modification by Pseudomonas RimK.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	S7 R8 Y13 S14 R64 G66 A67 S68 R189 N262 S264 G266
Binding residue (residue number reindexed from 1)	S7 R8 Y13 S14 R64 G66 A67 S68 R189 N262 S264 G266

Enzymatic activity

Enzyme Commision number

6.3.2.-

Gene Ontology

	Molecular Function
GO:0003824	catalytic activity
GO:0005524	ATP binding
GO:0016874	ligase activity
GO:0016881	acid-amino acid ligase activity
GO:0018169	ribosomal S6-glutamic acid ligase activity
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation
GO:0009432	SOS response
GO:0036211	protein modification process

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

PDB	RCSB:7qyr, PDBe:7qyr, PDBj:7qyr
PDBsum	7qyr
PubMed	36134899
UniProt	Q9HTZ2\|RIMK_PSEAE Probable alpha-L-glutamate ligase (Gene Name=rimK)