Structure of PDB 7p0u Chain A Binding Site BS01

Receptor Information
>7p0u Chain A (length=134) Species: 10258 (Orf virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQE
LSNAGEHNPENSHIPAALVSALLEPTSPGRMVTAVELCAQMGRLWTRGRQ
LVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVH
Ligand information
>7p0u Chain U (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RSSAAQLTAARLKALGDELHQRTMWR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7p0u Structural Investigation of Orf Virus Bcl-2 Homolog ORFV125 Interactions with BH3-Motifs from BH3-Only Proteins Puma and Hrk.
Resolution1.99374 Å
Binding residue
(original residue number in PDB)		E46 P50 E54 A73 L74 S76 A77 L78 E80 P85 G86 R87 W133 A136 R139
Binding residue
(residue number reindexed from 1)		E42 P46 E50 A67 L68 S70 A71 L72 E74 P78 G79 R80 W126 A129 R132
Enzymatic activity
Enzyme Commision number ?
External links