Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP

Structure of PDB 7bb6 Chain A Binding Site BS01

Receptor Information
>7bb6 Chain A (length=270) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPLLARAELALLSIVFVAVALSNGLVLAALARRGRRGHWAPIHVFIGHLC
LADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQMVGMYASSYMILA
MTLDRHRAICRPNRPVLVAWAFSLLLSLPQLFIFAQRNVEGGSGVTDCWA
CFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHAHVSAAVAKTV
RMTLVIVVVYVLCWAPFFLVQLWAAWDPEAPLEGAPFVLLMLLASLNSCT
NPWIYASFSSSVSSELRSLL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bb6 Cryo-electron microscopy structure of the antidiuretic hormone arginine-vasopressin V2 receptor signaling complex.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		M123 W193 A194 F307 M311 A314 S315
Binding residue
(residue number reindexed from 1)		M91 W149 A150 F237 M241 A244 S245
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0005000 vasopressin receptor activity
GO:0005515 protein binding
GO:0038023 signaling receptor activity
GO:0042277 peptide binding
Biological Process
GO:0001992 regulation of systemic arterial blood pressure by vasopressin
GO:0003084 positive regulation of systemic arterial blood pressure
GO:0003092 renal water retention
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007190 activation of adenylate cyclase activity
GO:0007599 hemostasis
GO:0008284 positive regulation of cell population proliferation
GO:0008285 negative regulation of cell population proliferation
GO:0010628 positive regulation of gene expression
GO:0021537 telencephalon development
GO:0032870 cellular response to hormone stimulus
GO:0034097 response to cytokine
GO:0035811 negative regulation of urine volume
GO:0045777 positive regulation of blood pressure
GO:0045907 positive regulation of vasoconstriction
GO:1902533 positive regulation of intracellular signal transduction
Cellular Component
GO:0005768 endosome
GO:0005783 endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030139 endocytic vesicle
GO:0030669 clathrin-coated endocytic vesicle membrane
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7bb6, PDBe:7bb6, PDBj:7bb6
PDBsum7bb6
PubMed34020960
UniProtP30518|V2R_HUMAN Vasopressin V2 receptor (Gene Name=AVPR2)

[Back to BioLiP]

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417