Structure of PDB 6r2i Chain A Binding Site BS01

Receptor Information
>6r2i Chain A (length=198) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGITEAQARAIVNSALKLYSQDKTGMVDFALESGGGSILSTRCSETYETK
TALMSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMMIH
PAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQD
GESLQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHGEPVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6r2i A molecular mechanism for LINC complex branching by structurally diverse SUN-KASH 6:6 assemblies.
Resolution1.541 Å
Binding residue
(original residue number in PDB)
E646 G649 S654 L667 P674 L675 W676 Y677 S679 S681 R683
Binding residue
(residue number reindexed from 1)
E32 G35 S40 L53 P60 L61 W62 Y63 S65 S67 R69
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6r2i, PDBe:6r2i, PDBj:6r2i
PDBsum6r2i
PubMed33393904
UniProtO94901|SUN1_HUMAN SUN domain-containing protein 1 (Gene Name=SUN1)

[Back to BioLiP]