Structure of PDB 6jjx Chain A Binding Site BS01

Receptor Information
>6jjx Chain A (length=118) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FELPLPEGWEEARDFDGKVYYIDHRNRTTSWIDPRDRYTKPLTFADCISD
ELPLGWEEAYDPQVGDYFIDHNTKTTQIEDPRVQWRREQEHMLKDYLVVA
QEALSAQKEIYQVKQQRL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jjx Decoding WW domain tandem-mediated target recognitions in tissue growth and cell polarity.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
E13 Y23 I25 H27 R30 T31 T32 W34
Binding residue
(residue number reindexed from 1)
E10 Y20 I22 H24 R27 T28 T29 W31
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6jjx, PDBe:6jjx, PDBj:6jjx
PDBsum6jjx
PubMed31486770
UniProtQ5SXA9|KIBRA_MOUSE Protein KIBRA (Gene Name=Wwc1)

[Back to BioLiP]