Structure of PDB 6ile Chain A Binding Site BS01

Receptor Information
>6ile Chain A (length=276) Species: 9402 (Pteropus alecto) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GFHSLRYFYTAWSRPGSGEPRFVAVGYVDDTQFVRFDSDNASPRAEPRAP
WVEQQDPQYWDRNTRNARDAAQTYRVGLDNVRGYYNQSEAGSHTIQRMYG
CDVGPHGRLLRGYDQLAYDGADYIALNEDLRSWTAADLAAQNTRRKWEEA
GYAERDRAYLEGECVEWLLKHLENGRETLLRADPPKTHITHHPISDREVT
LRCWALGFYPEEITLTWQHDGEDQTQEMELVETRPDGNGAFQKWAALVVP
SGEEQRYTCHVQHEGLPQPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ile Structure and Peptidome of the Bat MHC Class I Molecule Reveal a Novel Mechanism Leading to High-Affinity Peptide Binding.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		Y7 Y9 N63 N66 T73 Y74 G77 N80 Y84 Y99 T143 K146 W147 Y152 Y159 W167
Binding residue
(residue number reindexed from 1)		Y7 Y9 N63 N66 T73 Y74 G77 N80 Y84 Y99 T143 K146 W147 Y152 Y159 W167
Enzymatic activity
Enzyme Commision number ?
External links