Structure of PDB 6dql Chain A Binding Site BS01

Receptor Information
>6dql Chain A (length=227) Species: 1314 (Streptococcus pyogenes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NVDEFLFISNNFKQYKEFIDMDTAKHYFECRNIEGLNHILDSYKDSKSTK
EKNLFALVKVLLATLTEEDCLTERTYLSNYLINIETWSHYETVLFNNCMF
IFESCFIEMVFSKVILNLDKYNTLRYYGNESIRMFVNMLILFIQRQEYDK
ASEILAKIEDYQLNDDCLYERCCVSFFDGIIGLINGKEGAEQKCVQILEI
FQLLNCKTIHHMFQTYLEAIKHKLSLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dql Environmental pH and peptide signaling control virulence of Streptococcus pyogenes via a quorum-sensing pathway.
Resolution3.3 Å
Binding residue
(original residue number in PDB)
R188 N192 Q199 M267 F268
Binding residue
(residue number reindexed from 1)
R133 N137 Q144 M212 F213
Enzymatic activity
Enzyme Commision number ?
External links