Structure of PDB 5y1j Chain A Binding Site BS01

Receptor Information
>5y1j Chain A (length=226) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEAFSAEENFLILTEMATN
HVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKPSGHS
DLLEARIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDR
QYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFAKLLGRLTELRTFNH
HHAEMLMSWRVNDHKFTPLLQEIWDV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5y1j Crystal structure of human FXR in complex with a functional drug liagnd
Resolution2.0 Å
Binding residue
(original residue number in PDB)		V299 K303 H313 Q316 I317 K321 L464
Binding residue
(residue number reindexed from 1)		V56 K60 H70 Q73 I74 K78 L219
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
GO:0032052 bile acid binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0038183 bile acid signaling pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5y1j, PDBe:5y1j, PDBj:5y1j
PDBsum5y1j
PubMed
UniProtQ96RI1|NR1H4_HUMAN Bile acid receptor (Gene Name=NR1H4)

[Back to BioLiP]