Structure of PDB 5mtw Chain A Binding Site BS01

Receptor Information
>5mtw Chain A (length=138) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLDLQRVGARLAARAQIRDIRLLRTQAAVHRAPKQGLTYDLEFEPAVDAD
PATISAFVVRISCHLRIQNQADVATADFEFAALFDYHLQEGEDDPTEEEL
TAYAATTGRFALYPYIREYVYDLTGRLALPPLTLEILS
Ligand information
>5mtw Chain E (length=12) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EVPTWHRLSSYR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mtw Structural insights into chaperone addiction of toxin-antitoxin systems.
Resolution1.84 Å
Binding residue
(original residue number in PDB)		D27 I28 R29 D58 A59 V68 L108
Binding residue
(residue number reindexed from 1)		D19 I20 R21 D48 A49 V58 L83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0009274 peptidoglycan-based cell wall

View graph for
Cellular Component
External links
PDB RCSB:5mtw, PDBe:5mtw, PDBj:5mtw
PDBsum5mtw
PubMed30770830
UniProtP95257|SECBL_MYCTU SecB-like chaperone Rv1957 (Gene Name=secBL)

[Back to BioLiP]