BioLiP

Structure of PDB 5m0j Chain A Binding Site BS01

Receptor Information

>5m0j Chain A (length=223) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTL
IKFVKKLRFYNDSVLSYNASEFINADSFDKVILPIASMFVKSVETFDLLN
YYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRI
GSNLLDLEVVQFAIKSADEDGDNIFLQEILPVNSEEEFQTLSAAWHSILD
GKLSALDEEFDVVATKWHDKFGK

Ligand information

>5m0j Chain G (length=16) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NNKRRSFYTASPLPGV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5m0j Molecular architecture and dynamics of ASH1 mRNA recognition by its mRNA-transport complex.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	Y115 Q119 D145 E172 F176 Q197 E198 L211 W215
Binding residue (residue number reindexed from 1)	Y101 Q105 D131 E158 F162 Q177 E178 L191 W195

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0005515	protein binding
GO:0008289	lipid binding
GO:1990825	sequence-specific mRNA binding

	Biological Process
GO:0007533	mating type switching
GO:0008298	intracellular mRNA localization
GO:0051028	mRNA transport

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005934	cellular bud tip

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

PDB	RCSB:5m0j, PDBe:5m0j, PDBj:5m0j
PDBsum	5m0j
PubMed	28092367
UniProt	P36068\|SHE2_YEAST SWI5-dependent HO expression protein 2 (Gene Name=SHE2); P38272\|SHE3_YEAST SWI5-dependent HO expression protein 3 (Gene Name=SHE3)