Structure of PDB 5m0j Chain A Binding Site BS01

Receptor Information
>5m0j Chain A (length=223) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTL
IKFVKKLRFYNDSVLSYNASEFINADSFDKVILPIASMFVKSVETFDLLN
YYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRI
GSNLLDLEVVQFAIKSADEDGDNIFLQEILPVNSEEEFQTLSAAWHSILD
GKLSALDEEFDVVATKWHDKFGK
Ligand information
>5m0j Chain G (length=16) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NNKRRSFYTASPLPGV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5m0j Molecular architecture and dynamics of ASH1 mRNA recognition by its mRNA-transport complex.
Resolution2.8 Å
Binding residue
(original residue number in PDB)
Y115 Q119 D145 E172 F176 Q197 E198 L211 W215
Binding residue
(residue number reindexed from 1)
Y101 Q105 D131 E158 F162 Q177 E178 L191 W195
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0008289 lipid binding
GO:1990825 sequence-specific mRNA binding
Biological Process
GO:0007533 mating type switching
GO:0008298 intracellular mRNA localization
GO:0051028 mRNA transport
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005934 cellular bud tip

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5m0j, PDBe:5m0j, PDBj:5m0j
PDBsum5m0j
PubMed28092367
UniProtP36068|SHE2_YEAST SWI5-dependent HO expression protein 2 (Gene Name=SHE2);
P38272|SHE3_YEAST SWI5-dependent HO expression protein 3 (Gene Name=SHE3)

[Back to BioLiP]