Structure of PDB 5l83 Chain A Binding Site BS01

Receptor Information
>5l83 Chain A (length=112) Species: 4113 (Solanum tuberosum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPSFKLEHPLERRQAEAARIREKYPDRIPVIVEKAERSDIPDIDKKKYLV
PADLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEEHKDE
DGFLYMTYSGEN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5l83 Structural Basis of Host Autophagy-related Protein 8 (ATG8) Binding by the Irish Potato Famine Pathogen Effector Protein PexRD54.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		E18 I22 R29 K47 K49 Y50 L51 P53 F105
Binding residue
(residue number reindexed from 1)		E16 I20 R27 K45 K47 Y48 L49 P51 F103
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008429 phosphatidylethanolamine binding
Biological Process
GO:0000045 autophagosome assembly
GO:0000422 autophagy of mitochondrion
GO:0006914 autophagy
GO:0006995 cellular response to nitrogen starvation
GO:0050832 defense response to fungus
GO:0097352 autophagosome maturation
Cellular Component
GO:0000421 autophagosome membrane
GO:0005737 cytoplasm
GO:0005773 vacuole
GO:0005776 autophagosome
GO:0005856 cytoskeleton
GO:0009705 plant-type vacuole membrane
GO:0016020 membrane
GO:0031410 cytoplasmic vesicle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5l83, PDBe:5l83, PDBj:5l83
PDBsum5l83
PubMed27458016
UniProtM1C146|ATG8C_SOLTU Autophagy-related protein 8C-like (Gene Name=ATG8CL)

[Back to BioLiP]