Structure of PDB 5csz Chain A Binding Site BS01

Receptor Information
>5csz Chain A (length=212) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VELVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAI
NASGTRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGKG
YVRYFDVWGQGTLVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTV
SWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKP
SNTKVDKKVEPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5csz Gantenerumab: a novel human anti-Abeta antibody demonstrates sustained cerebral amyloid-Beta binding and elicits cell-mediated removal of human amyloid-Beta.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		Y32 A33 N52 A53 R57 Y59 Y60 G101 Y109 V110
Binding residue
(residue number reindexed from 1)		Y31 A32 N51 A52 R56 Y58 Y59 G100 Y101 V102
External links