BioLiP

Structure of PDB 5c26 Chain A Binding Site BS01

Receptor Information

>5c26 Chain A (length=274) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPA
LKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQ
NRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISD
FGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLM
WEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYD
VENRPGFAAVELRLRNYYYDVVNH

Ligand information

>5c26 Chain B (length=6) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EVYESP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5c26 Imidazotriazines: Spleen Tyrosine Kinase (Syk) Inhibitors Identified by Free-Energy Perturbation (FEP).
Resolution	1.95 Å
Binding residue (original residue number in PDB)	D494 R498 N499 D512 H531 G532 K533 W534 P535 G578
Binding residue (residue number reindexed from 1)	D132 R136 N137 D150 H169 G170 K171 W172 P173 G216

Enzymatic activity

Catalytic site (original residue number in PDB)	D494 A496 R498 N499 D512 K533
Catalytic site (residue number reindexed from 1)	D132 A134 R136 N137 D150 K171
Enzyme Commision number	2.7.10.2: non-specific protein-tyrosine kinase.

Gene Ontology

	Molecular Function
GO:0004672	protein kinase activity
GO:0004713	protein tyrosine kinase activity
GO:0005524	ATP binding

	Biological Process
GO:0006468	protein phosphorylation

View graph for
Molecular Function

View graph for
Biological Process

PDB	RCSB:5c26, PDBe:5c26, PDBj:5c26
PDBsum	5c26
PubMed	26381330
UniProt	P43405\|KSYK_HUMAN Tyrosine-protein kinase SYK (Gene Name=SYK)