Structure of PDB 4xh2 Chain A Binding Site BS01

Receptor Information
>4xh2 Chain A (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEVQLVESGGGLVQPGGSLRLSCAASGFNVSSYSIHWVRQAPGKGLEWVA
YISSSSGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCART
WYYGFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY
FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI
CNVNHKPSNTKVDKKVEPKS
Ligand information
>4xh2 Chain a (length=16) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSATRELDELMASLSD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xh2 Engineering Synthetic Antibody Inhibitors Specific for LD2 or LD4 Motifs of Paxillin.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		S31 S33 H35 Y50 Y56 Y58 T95 W96 Y97 Y98
Binding residue
(residue number reindexed from 1)		S32 S34 H36 Y51 Y58 Y60 T100 W101 Y102 Y103
External links