Structure of PDB 4v3i Chain A Binding Site BS01

Receptor Information

>4v3i Chain A (length=153) Species: 666 (Vibrio cholerae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DNPNVLIDAATPLFGLSLRVNIEQIYRQTIEEIKAIEIELTEQGYEHAIL
MAYRYILCAFLDESVMGTEWGASSLWAEHSMLSRFHNETWGGEKVFTILS
RLEGEPHRYQALLAFIYHCLILGFEGKYRVMEGGQAEREKVISRLHQLLS
SLE

Ligand information

>4v3i Chain B (length=5) Species: 666 (Vibrio cholerae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DLTRP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4v3i Crystal structure of the bacterial type VI secretion system component TssL from Vibrio cholerae.
Resolution	1.499 Å
Binding residue (original residue number in PDB)	A92 K134 R141
Binding residue (residue number reindexed from 1)	A52 K94 R101

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003674	molecular_function

	Biological Process
GO:0008150	biological_process

	Cellular Component
GO:0005575	cellular_component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v3i, PDBe:4v3i, PDBj:4v3i
PDBsum	4v3i
PubMed	25471186
UniProt	Q9KN50

[Back to BioLiP]