BioLiP

Structure of PDB 4rh9 Chain A Binding Site BS01

Receptor Information

>4rh9 Chain A (length=282) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ADTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGLAITFAKLPQNLDKNRY
KDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGPLPHTCA
QFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMNHGGFHIQCQS
EDCTIAYVSREMLVTNTQTGEEHTVTHLQYVAWPAFGVPDDSSDFLEFVN
YVRSLRVDSEPVLVHSSAGIGRTGVLVTMETAMCLTERNLPIYPLDIVRK
MRDQRAGMVQTSSQYKFVCEAILRVYEEGLVQ

Ligand information

>4rh9 Chain B (length=8) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

FSAYPSEE

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4rh9 Substrate specificity and plasticity of FERM-containing protein tyrosine phosphatases.
Resolution	1.598 Å
Binding residue (original residue number in PDB)	D672 Y676 K677 D678 F812 S842 S843 A844 I846 G847 R848 Q886
Binding residue (residue number reindexed from 1)	D46 Y50 K51 D52 F186 S216 S217 A218 I220 G221 R222 Q260

Enzymatic activity

Catalytic site (original residue number in PDB)	A811 S842 R848 T849 Q886
Catalytic site (residue number reindexed from 1)	A185 S216 R222 T223 Q260
Enzyme Commision number	3.1.3.48: protein-tyrosine-phosphatase.

Gene Ontology

	Molecular Function
GO:0004725	protein tyrosine phosphatase activity

	Biological Process
GO:0006470	protein dephosphorylation
GO:0016311	dephosphorylation

View graph for
Molecular Function

View graph for
Biological Process

PDB	RCSB:4rh9, PDBe:4rh9, PDBj:4rh9
PDBsum	4rh9
PubMed	25728925
UniProt	P26045\|PTN3_HUMAN Tyrosine-protein phosphatase non-receptor type 3 (Gene Name=PTPN3)