Structure of PDB 4j9g Chain A Binding Site BS01

Receptor Information

>4j9g Chain A (length=58) Species: 9606 (Homo sapiens)

PNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVP
SNYITPVN

Ligand information

>4j9g Chain B (length=10)

APTYPPPPPP

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4j9g Crystallization by capillary counter-diffusion and structure determination of the N114A mutant of the SH3 domain of Abl tyrosine kinase complexed with a high-affinity peptide ligand.
• Resolution: 1.8 Å
• Binding residue (original residue number in PDB): S75 E98 W99 W110 Y115
• Binding residue (residue number reindexed from 1): S13 E36 W37 W48 Y53

Enzymatic activity

• Enzyme Commision number: 2.7.10.2: non-specific protein-tyrosine kinase.

External links

• PDB: RCSB:4j9g, PDBe:4j9g, PDBj:4j9g
• PDBsum: 4j9g
• UniProt: P00519|ABL1_HUMAN Tyrosine-protein kinase ABL1 (Gene Name=ABL1)