Structure of PDB 4j9e Chain A Binding Site BS01

Receptor Information

>4j9e Chain A (length=56) Species: 9606 (Homo sapiens)

LFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSA
YITPVN

Ligand information

>4j9e Chain B (length=10)

APTYSPPLPP

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4j9e Crystallization by capillary counter-diffusion and structure determination of the N114A mutant of the SH3 domain of Abl tyrosine kinase complexed with a high-affinity peptide ligand.
• Resolution: 1.4 Å
• Binding residue (original residue number in PDB): Y70 S75 D77 E98 W99 W110 P112 Y115
• Binding residue (residue number reindexed from 1): Y6 S11 D13 E34 W35 W46 P48 Y51

Enzymatic activity

• Enzyme Commision number: 2.7.10.2: non-specific protein-tyrosine kinase.

External links

• PDB: RCSB:4j9e, PDBe:4j9e, PDBj:4j9e
• PDBsum: 4j9e
• UniProt: P00519|ABL1_HUMAN Tyrosine-protein kinase ABL1 (Gene Name=ABL1)