BioLiP

Structure of PDB 4j1j Chain A Binding Site BS01

Receptor Information

>4j1j Chain A (length=233) Species: 999729 (Leanyer virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TGPDFIYDDRPAAVSSTFNPEKGYMDFITAYGKNINADNVRIFFLNHKKA
KDSLKGSPKVEVDLQFGTLRVKVVNNHNPRNRDNPVADNAITLHRLSGYL
AKWCFDEIDHGQIEEAEVKSKVVIPLAEAKGCKWGDGVALYLAFAPGAEM
FLKDFEFYPLAIDIQRVVKDGMDITFMRKVLKQRYGTKTADDWMISEVTA
IQSAVKVVAKLPWAKAGFTAAAKNFLAKFNISV

Ligand information

>4j1j Chain H (length=17) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

accaaacaacccaccca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4j1j Structure of the Leanyer orthobunyavirus nucleoprotein-RNA complex reveals unique architecture for RNA encapsidation.
Resolution	2.65 Å
Binding residue (original residue number in PDB)	L47 H49 K50 K53 N78 H79 T94 L95 H96 R97 V125 P127 L128 E130 M174 F178 K181 K184
Binding residue (residue number reindexed from 1)	L45 H47 K48 K51 N76 H77 T92 L93 H94 R95 V123 P125 L126 E128 M172 F176 K179 K182
Binding affinity	PDBbind-CN: Kd=0.505uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

	Cellular Component
GO:0019013	viral nucleocapsid
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Cellular Component

PDB	RCSB:4j1j, PDBe:4j1j, PDBj:4j1j
PDBsum	4j1j
PubMed	23569220
UniProt	F2WAD7