Structure of PDB 3u85 Chain A Binding Site BS01

Receptor Information

>3u85 Chain A (length=484) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVN
RVIPTNVPELTFQPSPAPDPPGGLTYFPVADLSIIAALYARFTAQIRGAV
DLSLYPREGGVSSRELVKKVSDVIWNSLSRSYFKDRAHIQSLFSFITGTK
LDSSGVAFAVVGACQALGLRDVHLALSEDHAWVVFGPNGEQTAEVTWHGK
GNEDRRGQTVNAGVAERSWLYLKGSYMRCDRKMEVAFMVCAINPSIDLHT
DSLELLQLQQKLLWLLYDLGHLERYPMALGNLADLEELEPTPGRPDPLTL
YHKGIASAKTYYRDEHIYPYMYLAGYHCRNRNVREALQAWADTATVIQDY
NYCREDEEIYKEFFEVANDVIPNLLKEAASLLEASALQDPECFAHLLRFY
DGICKWEEGSPTPVLHVGWATFLVQSLGRFEGQVRQKVRIVSGTVAGTAR
GPVLTFQSEKMKGMKELLVATKINSSAIKLQLTA

Ligand information

>3u85 Chain B (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SRWRFPARP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3u85 The same pocket in menin binds both MLL and JUND but has opposite effects on transcription.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	D136 R137 A138 D153 S154 S155 D180 H181 F238 C241 S246 M278 Y319 Y323 E363
Binding residue (residue number reindexed from 1)	D135 R136 A137 D152 S153 S154 D179 H180 F237 C240 S245 M277 Y318 Y322 E362

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000400	four-way junction DNA binding
GO:0000403	Y-form DNA binding
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003682	chromatin binding
GO:0003690	double-stranded DNA binding
GO:0005515	protein binding
GO:0030674	protein-macromolecule adaptor activity
GO:0051219	phosphoprotein binding
GO:0070412	R-SMAD binding

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0000165	MAPK cascade
GO:0001933	negative regulation of protein phosphorylation
GO:0002076	osteoblast development
GO:0006281	DNA repair
GO:0006325	chromatin organization
GO:0006357	regulation of transcription by RNA polymerase II
GO:0006974	DNA damage response
GO:0008285	negative regulation of cell population proliferation
GO:0009411	response to UV
GO:0010332	response to gamma radiation
GO:0030511	positive regulation of transforming growth factor beta receptor signaling pathway
GO:0043433	negative regulation of DNA-binding transcription factor activity
GO:0045064	T-helper 2 cell differentiation
GO:0045668	negative regulation of osteoblast differentiation
GO:0045736	negative regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0045786	negative regulation of cell cycle
GO:0045815	transcription initiation-coupled chromatin remodeling
GO:0045892	negative regulation of DNA-templated transcription
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0046329	negative regulation of JNK cascade

	Cellular Component
GO:0000781	chromosome, telomeric region
GO:0000785	chromatin
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005788	endoplasmic reticulum lumen
GO:0005829	cytosol
GO:0016363	nuclear matrix
GO:0017053	transcription repressor complex
GO:0032154	cleavage furrow
GO:0032991	protein-containing complex
GO:0035097	histone methyltransferase complex
GO:0044665	MLL1/2 complex
GO:0071339	MLL1 complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3u85, PDBe:3u85, PDBj:3u85
PDBsum	3u85
PubMed	22327296
UniProt	O00255\|MEN1_HUMAN Menin (Gene Name=MEN1)

[Back to BioLiP]

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417