Structure of PDB 3rse Chain A Binding Site BS01

Receptor Information
>3rse Chain A (length=396) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKKGVDDLDFFIGDE
AIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEP
PLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTG
TVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGI
PPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKK
EFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPL
YKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVIT
HHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3rse Structural and biochemical characterization of two binding sites for nucleation-promoting factor WASp-VCA on Arp2/3 complex.
Resolution2.65 Å
Binding residue
(original residue number in PDB)
P236 D330 R333 R334 R341
Binding residue
(residue number reindexed from 1)
P221 D315 R318 R319 R326
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0051015 actin filament binding
Biological Process
GO:0010592 positive regulation of lamellipodium assembly
GO:0030030 cell projection organization
GO:0034314 Arp2/3 complex-mediated actin nucleation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0060271 cilium assembly
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005885 Arp2/3 protein complex
GO:0035861 site of double-strand break
GO:0042995 cell projection

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3rse, PDBe:3rse, PDBj:3rse
PDBsum3rse
PubMed21676862
UniProtP61157|ARP3_BOVIN Actin-related protein 3 (Gene Name=ACTR3)

[Back to BioLiP]