Structure of PDB 3mnw Chain A Binding Site BS01

Receptor Information
>3mnw Chain A (length=216) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDIQLTQSPSSLAMGQKVTMRCKSSQSLLNSRNERNYLAWYQQKPGQSPK
LLVYFASIRESGVPDRFIGSGSGTDFTLTISSVQAEDLADYFCLQHYNTP
WTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK
VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE
VTHQGLSSPVTKSFNR
Ligand information
>3mnw Chain P (length=19) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QEKNEQELLELDKWASLWN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mnw Crystal Structure of a Non-Neutralizing HIV-1 gp41 Envelope Antibody Demonstrates Neutralization Mechanism of gp41 Antibodies
Resolution2.2 Å
Binding residue
(original residue number in PDB)
L0 R30F Y49 F50
Binding residue
(residue number reindexed from 1)
L1 R35 Y54 F55
Enzymatic activity
Enzyme Commision number ?
External links