Structure of PDB 3ax5 Chain A Binding Site BS01

Receptor Information
>3ax5 Chain A (length=69) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLL
QVLQQTLPPPVFQMLLTKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ax5 Crystallographic snapshots of tom20-mitochondrial presequence interactions with disulfide-stabilized peptides.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		L71 I74 Q75 E78 E79 L106
Binding residue
(residue number reindexed from 1)		L14 I17 Q18 E21 E22 L49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006605 protein targeting
GO:0006886 intracellular protein transport
Cellular Component
GO:0005742 mitochondrial outer membrane translocase complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ax5, PDBe:3ax5, PDBj:3ax5
PDBsum3ax5
PubMed21591667
UniProtQ62760|TOM20_RAT Mitochondrial import receptor subunit TOM20 homolog (Gene Name=Tomm20)

[Back to BioLiP]