Structure of PDB 2rfd Chain A Binding Site BS01

Receptor Information
>2rfd Chain A (length=288) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREPKA
NKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREH
KDNIGSQYLLNWCVQIAEGMNYLEDRRLVHRDLAARNVLVKTPQHVKITD
FGLAKLLGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYD
GIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELII
EFSKMARDPQRYLVIQGDERMHLPEDMDDVVDADEYLI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rfd Inhibition of the EGF receptor by binding of MIG6 to an activating kinase domain interface.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		E904 K905 G906 E907 R908 P910 Y920 V924 M928 I929
Binding residue
(residue number reindexed from 1)		E212 K213 G214 E215 R216 P218 Y228 V232 M236 I237
Enzymatic activity
Catalytic site (original residue number in PDB) D813 A815 R817 N818 D831
Catalytic site (residue number reindexed from 1) D132 A134 R136 N137 D150
Enzyme Commision number 2.7.10.1: receptor protein-tyrosine kinase.
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004713 protein tyrosine kinase activity
GO:0005524 ATP binding
Biological Process
GO:0006468 protein phosphorylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2rfd, PDBe:2rfd, PDBj:2rfd
PDBsum2rfd
PubMed18046415
UniProtP00533|EGFR_HUMAN Epidermal growth factor receptor (Gene Name=EGFR)

[Back to BioLiP]