Structure of PDB 2r3c Chain A Binding Site BS01

Receptor Information
>2r3c Chain A (length=45) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Ligand information
>2r3c Chain C (length=14) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GACESPEWQWLCAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2r3c Potent D-peptide inhibitors of HIV-1 entry
Resolution1.73 Å
Binding residue
(original residue number in PDB)		E10 E13 S14 K17
Binding residue
(residue number reindexed from 1)		E10 E13 S14 K17
External links