Structure of PDB 2ltz Chain A Binding Site BS01

Receptor Information

>2ltz Chain A (length=37) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSAN

Ligand information

>2ltz Chain B (length=15) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ELESPPPPYSRYPMD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2ltz Structural Basis for the Versatile Interactions of Smad7 with Regulator WW Domains in TGF-beta Pathways.
Resolution	N/A
Binding residue (original residue number in PDB)	E304 R306 T308 R312 Y314 V316 D317 H318 R321 T322 T323 F325 T326
Binding residue (residue number reindexed from 1)	E8 R10 T12 R16 Y18 V20 D21 H22 R25 T26 T27 F29 T30

Enzymatic activity

Enzyme Commision number

2.3.2.26: HECT-type E3 ubiquitin transferase.

External links

PDB	RCSB:2ltz, PDBe:2ltz, PDBj:2ltz
PDBsum	2ltz
PubMed	22921829
UniProt	Q9HAU4\|SMUF2_HUMAN E3 ubiquitin-protein ligase SMURF2 (Gene Name=SMURF2)

[Back to BioLiP]