Structure of PDB 2lay Chain A Binding Site BS01

Receptor Information
>2lay Chain A (length=36) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2lay A Smad action turnover switch operated by WW domain readers of a phosphoserine code.
ResolutionN/A
Binding residue
(original residue number in PDB)
E178 Q186 Y188 T197 W199
Binding residue
(residue number reindexed from 1)
E9 Q17 Y19 T28 W30
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2lay, PDBe:2lay, PDBj:2lay
PDBsum2lay
PubMed21685363
UniProtP46937|YAP1_HUMAN Transcriptional coactivator YAP1 (Gene Name=YAP1)

[Back to BioLiP]