Structure of PDB 2k00 Chain A Binding Site BS01

Receptor Information
>2k00 Chain A (length=92) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKR
WAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2k00 Structural basis for the interaction between the cytoplasmic domain of the hyaluronate receptor layilin and the talin F3 subdomain
ResolutionN/A
Binding residue
(original residue number in PDB)		L353 T354 N355 I356 K357 R358 W359 A360 D369 G371 D372 I396
Binding residue
(residue number reindexed from 1)		L45 T46 N47 I48 K49 R50 W51 A52 D61 G63 D64 I88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:2k00, PDBe:2k00, PDBj:2k00
PDBsum2k00
PubMed18638481
UniProtP54939|TLN1_CHICK Talin-1 (Gene Name=TLN1)

[Back to BioLiP]