Structure of PDB 2j9n Chain A Binding Site BS01

Receptor Information

>2j9n Chain A (length=223) Species: 9913 (Bos taurus)

IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRL
GEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRV
ASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKS
AYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQK
NKPGVYTKVCNYVSWIKQTIASN

Ligand information

>2j9n Chain B (length=15) Species: 32630 (synthetic construct)

GGGGGGGGGGGGGGG

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2j9n Operator Assisted Harvesting of Protein Crystals Using a Universal Micromanipulation Robot.
• Resolution: 1.5 Å
• Binding residue (original residue number in PDB): N92 S93 L96
• Binding residue (residue number reindexed from 1): N77 S78 L81

Enzymatic activity

• Catalytic site (original residue number in PDB): H55 D99 Q189 G190 D191 S192 G193
• Catalytic site (residue number reindexed from 1): H40 D84 Q174 G175 D176 S177 G178
• Enzyme Commision number: 3.4.21.4: trypsin.

Gene Ontology

Molecular Function

• GO:0004175 endopeptidase activity
• GO:0004252 serine-type endopeptidase activity
• GO:0005515 protein binding
• GO:0008236 serine-type peptidase activity
• GO:0046872 metal ion binding
• GO:0097655 serpin family protein binding

Biological Process

• GO:0006508 proteolysis
• GO:0007586 digestion

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0097180 serine protease inhibitor complex

External links

• PDB: RCSB:2j9n, PDBe:2j9n, PDBj:2j9n
• PDBsum: 2j9n
• PubMed: 19461845
• UniProt: P00760|TRY1_BOVIN Serine protease 1 (Gene Name=PRSS1)