Structure of PDB 2ho2 Chain A Binding Site BS01

Receptor Information

>2ho2 Chain A (length=33) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGR

Ligand information

>2ho2 Chain B (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PPPPPPPPPL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2ho2 Structural Basis for Polyproline Recognition by the FE65 WW Domain.
Resolution	1.33 Å
Binding residue (original residue number in PDB)	Y269 W271 T278 W280
Binding residue (residue number reindexed from 1)	Y17 W19 T26 W28

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0001540	amyloid-beta binding

View graph for
Molecular Function

External links

PDB	RCSB:2ho2, PDBe:2ho2, PDBj:2ho2
PDBsum	2ho2
PubMed	17686488
UniProt	O00213\|APBB1_HUMAN Amyloid beta precursor protein binding family B member 1 (Gene Name=APBB1)

[Back to BioLiP]