Structure of PDB 2ain Chain A Binding Site BS01

Receptor Information
>2ain Chain A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGR
LAAGDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ain Solution structure and backbone dynamics of the AF-6 PDZ domain/Bcr peptide complex.
ResolutionN/A
Binding residue
(original residue number in PDB)		M17 G18 L19 S20 I21 V22 A23 K37 Q70 A74 M77 T78
Binding residue
(residue number reindexed from 1)		M17 G18 L19 S20 I21 V22 A23 K37 Q70 A74 M77 T78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005911 cell-cell junction

View graph for
Cellular Component
External links
PDB RCSB:2ain, PDBe:2ain, PDBj:2ain
PDBsum2ain
PubMed17473018
UniProtP55196|AFAD_HUMAN Afadin (Gene Name=AFDN)

[Back to BioLiP]