Structure of PDB 1zub Chain A Binding Site BS01

Receptor Information
>1zub Chain A (length=109) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HPVTWQPSKEGDRLIGRVILNKRTTMPKESGALLGLKVVGGKMTDLGRLG
AFITKVKKGSLADVVGHLRAGDEVLEWNGKPLPGATNEEVYNIILESKSE
PQVEIIVSR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zub Solution Structure of the RIM1alpha PDZ Domain in Complex with an ELKS1b C-terminal Peptide
ResolutionN/A
Binding residue
(original residue number in PDB)		L629 L630 G631 L632 K633 V634 V635 W673 Y687 K694
Binding residue
(residue number reindexed from 1)		L33 L34 G35 L36 K37 V38 V39 W77 Y91 K98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0031267 small GTPase binding
Biological Process
GO:0006887 exocytosis
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1zub, PDBe:1zub, PDBj:1zub
PDBsum1zub
PubMed16095618
UniProtQ9JIR4|RIMS1_RAT Regulating synaptic membrane exocytosis protein 1 (Gene Name=Rims1)

[Back to BioLiP]